PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.115620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 166aa    MW: 18759.3 Da    PI: 10.1424
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.115620.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv  +  +G  +W+++++  g++R++k+c++rw +yl
   Cucsa.115620.1 14 KGPWTAEEDKKLVTFILTYGHCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.93.5e-1672111647
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      + E++l +d+++ lG++ W++Ia++++ gRt++++k++w+++
   Cucsa.115620.1  72 ETEEQLVIDLHAHLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      67***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-22562IPR009057Homeodomain-like
PROSITE profilePS5129414.089961IPR017930Myb domain
SuperFamilySSF466891.35E-2711108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001675.80E-101661No hitNo description
PROSITE profilePS5129427.14262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2463117IPR009057Homeodomain-like
SMARTSM007178.9E-1466114IPR001005SANT/Myb domain
PfamPF002491.7E-1472111IPR001005SANT/Myb domain
CDDcd001672.01E-1072112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLVTFIL TYGHCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL DETEEQLVID LHAHLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPATHQPLK KQQTESSSQG SSTDSSVAIT TPLSEANSTT KEQPLX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-30141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818951e-129LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132631e-129LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143714.11e-120PREDICTED: protein ODORANT1
SwissprotQ50EX68e-89ODO1_PETHY; Protein ODORANT1
TrEMBLW9RQ266e-92W9RQ26_9R
STRINGVIT_16s0022g01210.t015e-89(Vitis vinifera)
STRINGSolyc08g079270.2.16e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65334142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.15e-88myb domain protein 42